PDB entry 1bqv

View 1bqv on RCSB PDB site
Description: pointed domain and map kinase phosphorylation site from murine ets-1 transcription factor, nmr, 28 structures
Class: transcription factor
Keywords: transcription factor, pointed domain, map kinase site, phosphorylation, proto-oncogene
Deposited on 1998-08-19, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-10-16, with a file datestamp of 2007-10-12.
Experiment type: NMR28
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ets-1
    Species: MUS MUSCULUS
    Gene: ETS-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bqva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqvA (A:)
    mecadvplltpsskemmsqalkatfsgftkeqqrlgipkdprqwtethvrdwvmwavnef
    slkgvdfqkfcmsgaalcalgkecflelapdfvgdilwehleilqkedvk