PDB entry 1bqu

View 1bqu on RCSB PDB site
Description: cytokyne-binding region of gp130
Class: signaling protein
Keywords: cytokine receptor, glycoprotein 130, gp130, interleukine 6 receptor beta subunit, signaling protein
Deposited on 1998-08-18, released 1998-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (gp130)
    Species: Homo sapiens [TaxId:9606]
    Gene: IL6ST
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40189
      • sequence conflict (210)
    Domains in SCOPe 2.07: d1bqua1, d1bqua2
  • Chain 'B':
    Compound: protein (gp130)
    Species: Homo sapiens [TaxId:9606]
    Gene: IL6ST
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40189 (0-214)
      • sequence conflict (0-2)
      • sequence conflict (210)
    Domains in SCOPe 2.07: d1bqub1, d1bqub2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bquA (A:)
    pgssglppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdt
    ptsctvdystvyfvnievwveaenalgkvtsdhinfdpvykvkpnpphnlsvinseelss
    ilkltwtnpsiksviilkyniqyrtkdastwsqippedtastrssftvqdlkpfteyvfr
    ircmkedgkgywsdwseeasgityedrpskepsfw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bquA (A:)
    glppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsc
    tvdystvyfvnievwveaenalgkvtsdhinfdpvykvkpnpphnlsvinslssilkltw
    tnpsiksviilkyniqyrtkdastwsqippedtastrssftvqdlkpfteyvfrircmke
    dgkgywsdwseeasgityedrpskepsf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bquB (B:)
    pgssglppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdt
    ptsctvdystvyfvnievwveaenalgkvtsdhinfdpvykvkpnpphnlsvinseelss
    ilkltwtnpsiksviilkyniqyrtkdastwsqippedtastrssftvqdlkpfteyvfr
    ircmkedgkgywsdwseeasgityedrpskepsfw