PDB entry 1bqt

View 1bqt on RCSB PDB site
Description: three-dimensional structure of human insulin-like growth factor-i (igf-i) determined by 1h-nmr and distance geometry, 6 structures
Deposited on 1998-08-18, released 1999-05-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-18, with a file datestamp of 1999-05-17.
Experiment type: NMR6
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1bqt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqt_ (-)
    gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
    caplkpaksa