PDB entry 1bqt

View 1bqt on RCSB PDB site
Description: three-dimensional structure of human insulin-like growth factor-I (igf-I) determined by 1h-nmr and distance geometry, 6 structures
Class: growth factor
Keywords: growth factor, insulin
Deposited on 1998-08-18, released 1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin-like growth factor-I
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05019 (0-69)
  Domains in SCOPe 2.08: d1bqta_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bqtA (A:)
  gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
  caplkpaksa