PDB entry 1bqs

View 1bqs on RCSB PDB site
Description: the crystal structure of mucosal addressin cell adhesion molecule-1 (madcam-1)
Class: membrane protein
Keywords: cell adhesion protein, madcam-1, immunoglobulin fold, I-set fold, cell adhesion glycoprotein, integrin recoginition, membrane protein
Deposited on 1998-08-18, released 1999-08-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (mucosal addressin cell adhesion molecule-1)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q13477 (0-208)
    • conflict (93)
  Domains in SCOPe 2.08: d1bqsa1, d1bqsa2
• Heterogens: NAG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bqsA (A:)
  vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
  naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
  dpnalsfsllvggqelegaqalgpevqeeeeepqgdedvlfrvterwrlpplgtpvppal
  ycqatmrlpglelshrqaipvlhsptspe