PDB entry 1bqr

View 1bqr on RCSB PDB site
Description: reduced pseudoazurin
Deposited on 1998-08-17, released 1999-08-17
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-17, with a file datestamp of 1999-08-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1bqr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqr_ (-)
    adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
    nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
    algn