PDB entry 1bqp

View 1bqp on RCSB PDB site
Description: the structure of the pea lectin-d-mannopyranose complex
Class: plant protein
Keywords: pea lectin, d-mannopyranose complex, carbohydrate binding
Deposited on 1998-08-17, released 1998-08-26
The last revision prior to the SCOP 1.73 freeze date was dated 2000-05-12, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.161
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lectin)
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1bqp.1
  • Chain 'B':
    Compound: protein (lectin)
    Species: Pisum sativum
    Domains in SCOP 1.73: d1bqp.1
  • Chain 'C':
    Compound: protein (lectin)
    Species: Pisum sativum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1bqp.2
  • Chain 'D':
    Compound: protein (lectin)
    Species: Pisum sativum
    Domains in SCOP 1.73: d1bqp.2
  • Heterogens: CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqpA (A:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    n
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqpB (B:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqpC (C:)
    tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
    anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
    dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
    n
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqpD (D:)
    vtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels