PDB entry 1bql

View 1bql on RCSB PDB site
Description: structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme
Class: antibody/antigen
Keywords: ANTIBODY/ANTIGEN complex, HYHEL-5, ANTI-LYSOZYME, BOBWHITE QUAIL
Deposited on 1995-02-03, released 1995-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.191
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: hyhel-5 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1BQL (Start-214)
    Domains in SCOPe 2.06: d1bqlh1, d1bqlh2
  • Chain 'L':
    Compound: hyhel-5 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB34980 (1-211)
      • conflict (17)
      • conflict (25)
      • conflict (29)
      • conflict (32)
      • conflict (58)
      • conflict (78)
      • conflict (90-92)
      • conflict (110)
    Domains in SCOPe 2.06: d1bqll1, d1bqll2
  • Chain 'Y':
    Compound: bobwhite quail lysozyme
    Species: Colinus virginianus [TaxId:9014]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bqly_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1bqlH (H:)
    evqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstny
    herfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvssaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpssprpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bqlH (H:)
    vqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstnyh
    erfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvssakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqlL (L:)
    divltqspaimsaspgekvtmtcsasssvnymywyqqksgtspkrwiydtsklasgvpvr
    fsgsgsgtsysltissmetedaatyycqqwgrnptfgggtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqlY (Y:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
    rwwcndgktpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl