PDB entry 1bql

View 1bql on RCSB PDB site
Description: structure of an anti-hel fab fragment complexed with bobwhite quail lysozyme
Deposited on 1995-02-03, released 1995-04-20
The last revision prior to the SCOP 1.55 freeze date was dated 1995-04-20, with a file datestamp of 1995-04-27.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.191
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqlH (H:)
    vqlqqsgaelmkpgasvkisckasgytfsdywiewvkqrpghglewigeilpgsgstnyh
    erfkgkatftadtssstaymqlnsltsedsgvyyclhgnydfdgwgqgttltvssakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpssprpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqlL (L:)
    divltqspaimsaspgekvtmtcsasssvnymywyqqksgtspkrwiydtsklasgvpvr
    fsgsgsgtsysltissmetedaatyycqqwgrnptfgggtkleikradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqlY (Y:)
    kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfnsqatnrntdgstdygvlqins
    rwwcndgktpgsrnlcnipcsallssditatvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl