PDB entry 1bqk

View 1bqk on RCSB PDB site
Description: oxidized pseudoazurin
Deposited on 1998-08-17, released 1999-08-17
The last revision prior to the SCOP 1.59 freeze date was dated 1999-08-17, with a file datestamp of 1999-08-16.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.176
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1bqk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bqk_ (-)
    adfevhmlnkgkdgamvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
    nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
    algn