PDB entry 1bqi

View 1bqi on RCSB PDB site
Description: use of papain as a model for the structure-based design of cathepsin k inhibitors. crystal structures of two papain inhibitor complexes demonstrate binding to s'-subsites.
Class: hydrolase
Keywords: hydrolase, sulfhydryl proteinase, papain
Deposited on 1998-08-16, released 1999-08-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: papain
  Species: Carica papaya [TaxId:3649]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00784 (0-211)
    • conflict (46)
    • conflict (117)
    • conflict (134)
  Domains in SCOPe 2.08: d1bqia_
• Heterogens: SBA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bqiA (A:)
  ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
  ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
  llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
  wgengyirikrgtgnsygvcglytssfypvkn