PDB entry 1bqg

View 1bqg on RCSB PDB site
Description: the structure of the d-glucarate dehydratase protein from pseudomonas putida
Deposited on 1998-08-15, released 1999-05-18
The last revision prior to the SCOP 1.71 freeze date was dated 1999-05-18, with a file datestamp of 1999-05-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1bqg_ (-)
    mealnqsqaatgapvitdlkvvpvaghdsmllnlsgahgplftrnililtdssghvgvge
    vpggegirktledarhllinqsignyqsllnkvrnafadrdvggrglqtfdlriavhavt
    avesalldllgqhlqvpvaallgegqqrdavemlgylfyvgdrnktdlgyrseheadnew
    frlrnkealtpesvvalaeaaydrygfkdfklkggvlrgedeiaavtalserfpdaritl
    dpngawslkeavalcrdqhhvlayaedpcgaengysgrevmaefrrstglrtatnmiatd
    wrqmghaiqlqsvdipladphfwtmqgsvrvaqmcnewgltwgshsnnhfdislamfthv
    aaaapgnitaidthwiwqdgqrltkeplqikgglvevpkkpglgveldwdalmkahevyk
    smglgarddatamrylvsgwefnnkrpcmvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bqg_ (-)
    gapvitdlkvvpvaghdsmllnlsgahgplftrnililtdssghvgvgevpggegirktl
    edarhllinqsignyqsllnkvrnafadlriavhavtavesalldllgqhlqvpvaallg
    egqqrdavemlgylfyvgdrnktdlgyrseheadnewfrlrnkealtpesvvalaeaayd
    rygfkdfklkggvlrgedeiaavtalserfpdaritldpngawslkeavalcrdqhhvla
    yaedpcgaengysgrevmaefrrstglrtatnmiatdwrqmghaiqlqsvdipladphfw
    tmqgsvrvaqmcnewgltwgshsnnhfdislamfthvaaaapgnitaidthwiwqdgqrl
    tkeplqikgglvevpkkpglgveldwdalmkahevyksm