PDB entry 1bq9

View 1bq9 on RCSB PDB site
Description: rubredoxin (formyl methionine mutant) from pyrococcus furiosus
Class: metal binding protein
Keywords: iron-sulfur protein, high-resolution structure
Deposited on 1998-08-22, released 1998-08-26
The last revision prior to the SCOP 1.75 freeze date was dated 1999-12-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.137
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (rubredoxin)
    Species: PYROCOCCUS FURIOSUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1bq9a_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq9A (A:)
    makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled