PDB entry 1bq8

View 1bq8 on RCSB PDB site
Description: Rubredoxin (Methionine Mutant) from Pyrococcus Furiosus
Class: metal binding protein
Keywords: iron-sulfur protein, high-resolution structure, metal binding protein
Deposited on 1998-08-22, released 1998-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (rubredoxin)
  Species: Pyrococcus furiosus, synthetic [TaxId:2261]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24297 (0-53)
  Domains in SCOPe 2.08: d1bq8a_
• Heterogens: FE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bq8A (A:)
  makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled