PDB entry 1bq7

View 1bq7 on RCSB PDB site
Description: dsba mutant p151a, role of the cis-proline in the active site of dsba
Class: oxidoreductase
Keywords: disulfide oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center
Deposited on 1998-08-21, released 1999-08-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (disulfide oxidoreductase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991
      • engineered (150)
    Domains in SCOPe 2.07: d1bq7a_
  • Chain 'B':
    Compound: protein (disulfide oxidoreductase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991
      • engineered (150)
    Domains in SCOPe 2.07: d1bq7b_
  • Chain 'C':
    Compound: protein (disulfide oxidoreductase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991
      • engineered (150)
    Domains in SCOPe 2.07: d1bq7c_
  • Chain 'D':
    Compound: protein (disulfide oxidoreductase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991
      • engineered (150)
    Domains in SCOPe 2.07: d1bq7d_
  • Chain 'E':
    Compound: protein (disulfide oxidoreductase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991
      • engineered (150)
    Domains in SCOPe 2.07: d1bq7e_
  • Chain 'F':
    Compound: protein (disulfide oxidoreductase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991
      • engineered (150)
    Domains in SCOPe 2.07: d1bq7f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bq7A (A:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bq7A (A:)
    qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bq7B (B:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bq7B (B:)
    qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylse
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bq7C (C:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bq7C (C:)
    qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylse
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bq7D (D:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bq7D (D:)
    qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylse
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1bq7E (E:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bq7E (E:)
    qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylse
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1bq7F (F:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bq7F (F:)
    qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylse