PDB entry 1bq5

View 1bq5 on RCSB PDB site
Description: nitrite reductase from alcaligenes xylosoxidans gifu 1051
Class: oxidoreductase
Keywords: oxidoreductase, nitrite reductase, cuproprotein
Deposited on 1998-08-21, released 1999-08-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Achromobacter xylosoxidans [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601
      • conflict (230)
    Domains in SCOPe 2.03: d1bq5a1, d1bq5a2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bq5A (A:)
    agtawaqdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlq
    amtfngsmpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqa
    tlrfkadrsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytige
    fdlyipkgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltgadaltakvget
    vllihsqanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgv
    yaylnhnlieafelgaaghikvegkwnddlmkqikapapipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bq5A (A:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltgadaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaaghikvegkwnddlmkqikapapi