PDB entry 1bq4

View 1bq4 on RCSB PDB site
Description: saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate
Deposited on 1998-08-20, released 1998-08-26
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bq4a_
  • Chain 'B':
    Domains in SCOP 1.55: d1bq4b_
  • Chain 'C':
    Domains in SCOP 1.55: d1bq4c_
  • Chain 'D':
    Domains in SCOP 1.55: d1bq4d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq4A (A:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq4B (B:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq4C (C:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq4D (D:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaa