PDB entry 1bq4

View 1bq4 on RCSB PDB site
Description: saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate
Class: isomerase
Keywords: isomerase, transferase (phosphoryl), glycolytic enzyme
Deposited on 1998-08-20, released 1998-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phosphoglycerate mutase 1)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bq4a_
  • Chain 'B':
    Compound: protein (phosphoglycerate mutase 1)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bq4b_
  • Chain 'C':
    Compound: protein (phosphoglycerate mutase 1)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bq4c_
  • Chain 'D':
    Compound: protein (phosphoglycerate mutase 1)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bq4d_
  • Heterogens: SO4, BHC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bq4A (A:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaagaaav
    anqgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bq4A (A:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bq4B (B:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaagaaav
    anqgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bq4B (B:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bq4C (C:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaagaaav
    anqgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bq4C (C:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bq4D (D:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaagaaav
    anqgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bq4D (D:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaa