PDB entry 1bq1

View 1bq1 on RCSB PDB site
Description: e. coli thymidylate synthase mutant n177a in complex with cb3717 and 2'-deoxyuridine 5'-monophosphate (dump)
Class: transferase
Keywords: transferase, active site mutant, reaction intermediate
Deposited on 1998-08-20, released 1999-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.152
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: thyA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A884 (1-263)
      • engineered (176)
    Domains in SCOPe 2.07: d1bq1a_
  • Chain 'B':
    Compound: Thymidylate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: thyA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A884 (1-263)
      • engineered (176)
    Domains in SCOPe 2.07: d1bq1b_
  • Heterogens: UMP, CB3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq1A (A:)
    mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
    wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
    ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfaias
    yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
    dyrfedfeiegydphpgikapvai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bq1B (B:)
    mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
    wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
    ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfaias
    yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
    dyrfedfeiegydphpgikapvai