PDB entry 1bpt

View 1bpt on RCSB PDB site
Description: crevice-forming mutants of bpti: crystal structures of f22a, y23a, n43g, and f45a
Class: proteinase inhibitor (trypsin)
Keywords: proteinase inhibitor (trypsin)
Deposited on 1991-12-11, released 1993-01-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bovine pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-End)
      • conflict (22)
    Domains in SCOPe 2.05: d1bpta_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bptA (A:)
    rpdfcleppytgpckariiryfanakaglcqtfvyggcrakrnnfksaedcmrtcgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bptA (A:)
    rpdfcleppytgpckariiryfanakaglcqtfvyggcrakrnnfksaedcmrtcg