PDB entry 1bpr

View 1bpr on RCSB PDB site
Description: nmr structure of the substrate binding domain of dnak, minimized average structure
Deposited on 1998-08-11, released 1999-03-02
The last revision prior to the SCOP 1.67 freeze date was dated 1999-04-27, with a file datestamp of 1999-04-26.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1bpr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1bpr_ (-)
    rgshhhhhhgsiegrvkdvllldvtplslgietmggvmttliaknttiptkhsqvfstae
    dnqsavtihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakd
    knsgkeqkitikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqv
    eeagdklpadd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bpr_ (-)
    siegrvkdvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihv
    lqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkit
    ikassglnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveea