PDB entry 1bpq

View 1bpq on RCSB PDB site
Description: phospholipase a2 engineering. x-ray structural and functional evidence for the interaction of lysine-56 with substrates
Deposited on 1991-10-28, released 1993-10-31
The last revision prior to the SCOP 1.71 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1bpq__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bpq_ (-)
  alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqamklds
  ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
  knc