PDB entry 1bpq

View 1bpq on RCSB PDB site
Description: phospholipase a2 engineering. x-ray structural and functional evidence for the interaction of lysine-56 with substrates
Class: carboxylic ester hydrolase
Keywords: carboxylic ester hydrolase
Deposited on 1991-10-28, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00593 (0-122)
    • conflict (55)
  Domains in SCOPe 2.08: d1bpqa_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bpqA (A:)
  alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqamklds
  ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
  knc