PDB entry 1bpq

View 1bpq on RCSB PDB site
Description: phospholipase a2 engineering. x-ray structural and functional evidence for the interaction of lysine-56 with substrates
Class: carboxylic ester hydrolase
Keywords: carboxylic ester hydrolase
Deposited on 1991-10-28, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00593 (0-122)
      • conflict (55)
    Domains in SCOPe 2.07: d1bpqa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bpqA (A:)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncykqamklds
    ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
    knc