PDB entry 1bpo

View 1bpo on RCSB PDB site
Description: clathrin heavy-chain terminal domain and linker
Deposited on 1998-08-11, released 1998-12-16
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.226
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bpoA (A:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bpoA (A:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bpoB (B:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bpoB (B:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bpoC (C:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnkviqcfae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bpoC (C:)
    maqilpirfqehlqlqnlginpanigfstltmesdkficirekvgeqaqvviidmndpsn
    pirrpisadsaimnpaskvialkagktlqifniemkskmkahtmtddvtfwkwislntva
    lvtdnavyhwsmegesqpvkmfdrhsslagcqiinyrtdakqkwllltgisaqqnrvvga
    mqlysvdrkvsqpieghaasfaqfkmegnaeestlfcfavrgqaggklhiievgtpptgn
    qpfpkkavdvffppeaqndfpvamqisekhdvvflitkygyihlydletgtciymnrisg
    etifvtapheatagiigvnrkgqvlsvcveeeniipyitnvlqnpdlalrmavrnnlaga
    eelfarkfnalfaqgnyseaakvaanapkgilrtpdtirrfqsvpaqpgqtspllqyfgi
    lldqgqlnkyeslelcrpvlqqgrkqllekwlkedklecseelgdlvksvdptlalsvyl
    ranvpnk