PDB entry 1bpn

View 1bpn on RCSB PDB site
Description: differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography
Class: hydrolase(alpha-aminoacylpeptide)
Keywords: hydrolase(alpha-aminoacylpeptide)
Deposited on 1993-03-02, released 1993-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.188
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucine aminopeptidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00727 (0-End)
      • conflict (44)
    Domains in SCOPe 2.08: d1bpna1, d1bpna2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bpnA (A:)
    tkglvlgiyskekeedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhed
    fpsvvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaa
    egavlglyeyddlkqkrkvvvsaklhgsedqeawqrgvlfasgqnlarrlmetpanemtp
    tkfaeiveenlksasiktdvfirpkswieeqemgsflsvakgseeppvfleihykgspna
    sepplvfvgkgitfdsggisikaaanmdlmradmggaaticsaivsaakldlpinivgla
    plcenmpsgkankpgdvvrarngktiqvdntdaegrliladalcyahtfnpkviinaatl
    tgamdialgsgatgvftnsswlwnklfeasietgdrvwrmplfehytrqvidcqladvnn
    igkyrsagactaaaflkefvthpkwahldiagvmtnkdevpylrkgmagrptrtlieflf
    rfsqdsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bpnA (A:)
    tkglvlgiyskedepqftsagenfnklvsgklreilnisgpplkagktrtfyglhedfps
    vvvvglgkktagideqenwhegkeniraavaagcrqiqdleipsvevdpcgdaqaaaega
    vlglyeyddlkqkrkvvvsaklhgsedqeawqrgvlfasgqnlarrlmetpanemtptkf
    aeiveenlksasiktdvfirpkswieeqemgsflsvakgseeppvfleihykgspnasep
    plvfvgkgitfdsggisikaaanmdlmradmggaaticsaivsaakldlpinivglaplc
    enmpsgkankpgdvvrarngktiqvdntdaegrliladalcyahtfnpkviinaatltga
    mdialgsgatgvftnsswlwnklfeasietgdrvwrmplfehytrqvidcqladvnnigk
    yrsagactaaaflkefvthpkwahldiagvmtnkdevpylrkgmagrptrtlieflfrfs
    q