PDB entry 1bpl

View 1bpl on RCSB PDB site
Description:
Deposited on 1995-07-13, released 1996-08-17
The last revision prior to the SCOP 1.55 freeze date was dated 1996-08-17, with a file datestamp of 1996-09-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.167
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1bpl.1
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1bpl.1, d1bplb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bplA (A:)
    lngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqadvgygaydly
    dlgefhqkgtvrtkygtkgelqsaikslhsrdinvygdvvinhkggadatedvtavevdp
    adrnrvisgehlikawthfhfpgrgstysdfkwhwyhfdgtdwdesrklnriykfqgka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bplB (B:)
    ydylmyadidydhpdvaaeikrwgtwyanelqldgfrldavkhikfsflrdwvnhvrekt
    gkemftvaeywqndlgalenylnktnfnhsvfdvplhyqfhaastqgggydmrkllnstv
    vskhplkavtfvdnhdtqpgqslestvqtwfkplayafiltresgypqvfygdmygtkgd
    sqreipalkhkiepilkarkqyaygaqhdyfdhhdivgwtregdssvansglaalitdgp
    ggakrmyvgrqnagetwhditgnrsepvvinsegwgefhvnggsvsiyvq