PDB entry 1bpl

View 1bpl on RCSB PDB site
Description: glycosyltransferase
Class: glycosyltransferase
Keywords: alpha-1,4-glucan-4-glucanohydrolase, alpha-amylase glycosyltransferase
Deposited on 1995-07-13, released 1996-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.167
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1,4-glucan-4-glucanohydrolase
    Species: Bacillus licheniformis [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bpl.1
  • Chain 'B':
    Compound: alpha-1,4-glucan-4-glucanohydrolase
    Species: Bacillus licheniformis [TaxId:1402]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bpl.1, d1bplb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bplA (A:)
    anlngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqadvgygayd
    lydlgefhqkgtvrtkygtkgelqsaikslhsrdinvygdvvinhkggadatedvtavev
    dpadrnrvisgehlikawthfhfpgrgstysdfkwhwyhfdgtdwdesrklnriykfqgk
    awdwevsne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bplA (A:)
    lngtlmqyfewympndgqhwkrlqndsaylaehgitavwippaykgtsqadvgygaydly
    dlgefhqkgtvrtkygtkgelqsaikslhsrdinvygdvvinhkggadatedvtavevdp
    adrnrvisgehlikawthfhfpgrgstysdfkwhwyhfdgtdwdesrklnriykfqgka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bplB (B:)
    ngnydylmyadidydhpdvaaeikrwgtwyanelqldgfrldavkhikfsflrdwvnhvr
    ektgkemftvaeywqndlgalenylnktnfnhsvfdvplhyqfhaastqgggydmrklln
    stvvskhplkavtfvdnhdtqpgqslestvqtwfkplayafiltresgypqvfygdmygt
    kgdsqreipalkhkiepilkarkqyaygaqhdyfdhhdivgwtregdssvansglaalit
    dgpggakrmyvgrqnagetwhditgnrsepvvinsegwgefhvnggsvsiyvqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bplB (B:)
    ydylmyadidydhpdvaaeikrwgtwyanelqldgfrldavkhikfsflrdwvnhvrekt
    gkemftvaeywqndlgalenylnktnfnhsvfdvplhyqfhaastqgggydmrkllnstv
    vskhplkavtfvdnhdtqpgqslestvqtwfkplayafiltresgypqvfygdmygtkgd
    sqreipalkhkiepilkarkqyaygaqhdyfdhhdivgwtregdssvansglaalitdgp
    ggakrmyvgrqnagetwhditgnrsepvvinsegwgefhvnggsvsiyvq