PDB entry 1bph

View 1bph on RCSB PDB site
Description: conformational changes in cubic insulin crystals in the ph range 7-11
Deposited on 1992-10-30, released 1993-01-15
The last revision prior to the SCOP 1.61 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.16
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1bph.1
  • Chain 'B':
    Domains in SCOP 1.61: d1bph.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bphA (A:)
giveqccasvcslyqlenycn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bphB (B:)
fvnqhlcgshlvealylvcgergffytpka