PDB entry 1bpb

View 1bpb on RCSB PDB site
Description: crystal structure of rat DNA polymerase beta: evidence for a common polymerase mechanism
Class: nucleotidyltransferase
Keywords: nucleotidyltransferase
Deposited on 1994-04-12, released 1994-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase beta
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bpba1, d1bpba2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bpbA (A:)
    irqddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfe
    kripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskq
    pkllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyyc
    gvlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwry
    repkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bpbA (A:)
    ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekri
    preemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkl
    lhrvveqlqkvrfitdtlskgetkfmgvcqlpseneyphrridirlipkdqyycgvlyft
    gsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepkdr
    se