PDB entry 1bp7

View 1bp7 on RCSB PDB site
Description: group i mobile intron endonuclease i-crei complexed with homing site dna
Deposited on 1998-08-13, released 1999-01-06
The last revision prior to the SCOP 1.71 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.234
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1bp7a_
  • Chain 'B':
    Domains in SCOP 1.71: d1bp7b_
  • Chain 'C':
    Domains in SCOP 1.71: d1bp7c_
  • Chain 'D':
    Domains in SCOP 1.71: d1bp7d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bp7A (A:)
    ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bp7B (B:)
    ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bp7C (C:)
    ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bp7D (D:)
    ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld