PDB entry 1bp7

View 1bp7 on RCSB PDB site
Description: group I mobile intron endonuclease I-crei complexed with homing site DNA
Class: transcription/DNA
Keywords: endonuclease, group I mobile intron, intron homing, chloroplast DNA, laglidadg motif, DNA complex, transcription/DNA complex
Deposited on 1998-08-13, released 1999-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.234
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: DNA (5'-d(*gp*cp*ap*ap*ap*ap*cp*gp*tp*cp*gp*tp*gp*ap*gp*ap*cp*ap*gp*tp*tp*tp* cp*g)-3')
  • Chain '2':
    Compound: DNA (5'-d(*cp*gp*ap*ap*ap*cp*tp*gp*tp*cp*tp*cp*ap*cp*gp*ap*cp*gp*tp*tp*tp*tp* gp*c)-3')
  • Chain '3':
    Compound: DNA (5'-d(*gp*cp*ap*ap*ap*ap*cp*gp*tp*cp*gp*tp*gp*ap*gp*ap*cp*ap*gp*tp*tp*tp* cp*g)-3')
  • Chain '4':
    Compound: DNA (5'-d(*cp*gp*ap*ap*ap*cp*tp*gp*tp*cp*tp*cp*ap*cp*gp*ap*cp*gp*tp*tp*tp*tp* gp*c)-3')
  • Chain 'A':
    Compound: protein (I-crei)
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05725 (0-151)
      • see remark 999 (40)
      • see remark 999 (108-109)
    Domains in SCOPe 2.07: d1bp7a_
  • Chain 'B':
    Compound: protein (I-crei)
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05725 (0-151)
      • see remark 999 (40)
      • see remark 999 (108-109)
    Domains in SCOPe 2.07: d1bp7b_
  • Chain 'C':
    Compound: protein (I-crei)
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05725 (0-151)
      • see remark 999 (40)
      • see remark 999 (108-109)
    Domains in SCOPe 2.07: d1bp7c_
  • Chain 'D':
    Compound: protein (I-crei)
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05725 (0-151)
      • see remark 999 (40)
      • see remark 999 (108-109)
    Domains in SCOPe 2.07: d1bp7d_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain '1':
    No sequence available.

  • Chain '2':
    No sequence available.

  • Chain '3':
    No sequence available.

  • Chain '4':
    No sequence available.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bp7A (A:)
    ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bp7B (B:)
    ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bp7C (C:)
    ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bp7D (D:)
    ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld