PDB entry 1bp1

View 1bp1 on RCSB PDB site
Description: crystal structure of bpi, the human bactericidal permeability-increasing protein
Class: bactericidal
Keywords: bactericidal, permeability-increasing, lipid-binding, lipopolysaccharide-binding, antibiotic
Deposited on 1997-04-08, released 1997-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bactericidal/permeability-increasing protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17213 (0-455)
      • engineered (350)
    Domains in SCOPe 2.07: d1bp1a1, d1bp1a2
  • Heterogens: PC1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bp1A (A:)
    vnpgvvvrisqkgldyasqqgtaalqkelkrikipdysdsfkikhlgkghysfysmdire
    fqlpssqismvpnvglkfsisnanikisgkwkaqkrflkmsgnfdlsiegmsisadlklg
    snptsgkptitcsscsshinsvhvhiskskvgwliqlfhkkiesalrnkmnsqvcekvtn
    svssklqpyfqtlpvmtkidsvaginyglvappattaetldvqmkgefysenhhnpppfa
    ppvmefpaahdrmvylglsdyffntaglvyqeagvlkmtlrddmipkeskfrlttkffgt
    flpevakkfpnmkiqihvsastpphlsvqptgltfypavdvqafavlpnsalaslfligm
    httgsmevsaesnrlvgelkldrlllelkhsnigpfpvellqdimnyivpilvlprvnek
    lqkgfplptparvqlynvvlqphqnfllfgadvvyk