PDB entry 1bp0

View 1bp0 on RCSB PDB site
Description: thymidylate synthase r23i mutant
Class: transferase
Keywords: methyltransferase, nucleotide biosynthesis, transferase
Deposited on 1998-08-11, released 1998-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (thymidylate synthase)
    Species: Lactobacillus casei [TaxId:1582]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00469 (0-315)
      • engineered (22)
    Domains in SCOPe 2.07: d1bp0a_
  • Heterogens: K, UMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bp0A (A:)
    mleqpyldlakkvldeghfkpdithtgtysifghqmrfdlskgfpllttkkvpfglikse
    llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
    emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
    ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
    ahecglevgefihtfgdahlyvnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
    llnydpypaikapvav