PDB entry 1box

View 1box on RCSB PDB site
Description: n39s mutant of RNAse sa from streptomyces aureofaciens
Class: hydrolase
Keywords: hydrolase, ribonuclease, mutant
Deposited on 1998-08-07, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanyl-specific ribonuclease sa
    Species: Streptomyces aureofaciens [TaxId:1894]
    Gene: U39467
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1boxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1boxA (A:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqsresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidqtc

    Sequence, based on observed residues (ATOM records): (download) 
    >1boxA (A:)
vsgtvclsalppeatdtlnliasdgpfpysqdgvvfqsresvlptqsygyyheytvitpg
artrgtrriitgeatqedyytgdhyatfslidqtc