PDB entry 1bov

View 1bov on RCSB PDB site
Description: crystal structure of the cell-binding b oligomer of verotoxin-1 from e. coli
Class: toxin
Keywords: toxin
Deposited on 1991-10-08, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.177
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: verotoxin-1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bova_
  • Chain 'B':
    Compound: verotoxin-1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bovb_
  • Chain 'C':
    Compound: verotoxin-1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bovc_
  • Chain 'D':
    Compound: verotoxin-1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bovd_
  • Chain 'E':
    Compound: verotoxin-1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bove_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bovA (A:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bovB (B:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bovC (C:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bovD (D:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bovE (E:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr