PDB entry 1bov

View 1bov on RCSB PDB site
Description: crystal structure of the cell-binding b oligomer of verotoxin-1 from e. coli
Class: toxin
Keywords: toxin
Deposited on 1991-10-08, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.177
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: verotoxin-1
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P69178 (0-68)
  Domains in SCOPe 2.07: d1bova_
• Chain 'B':
  Compound: verotoxin-1
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P69178 (0-68)
  Domains in SCOPe 2.07: d1bovb_
• Chain 'C':
  Compound: verotoxin-1
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P69178 (0-68)
  Domains in SCOPe 2.07: d1bovc_
• Chain 'D':
  Compound: verotoxin-1
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P69178 (0-68)
  Domains in SCOPe 2.07: d1bovd_
• Chain 'E':
  Compound: verotoxin-1
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P69178 (0-68)
  Domains in SCOPe 2.07: d1bove_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bovA (A:)
  tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
  ggfsevifr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bovB (B:)
  tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
  ggfsevifr
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bovC (C:)
  tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
  ggfsevifr
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bovD (D:)
  tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
  ggfsevifr
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bovE (E:)
  tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
  ggfsevifr