PDB entry 1bou

View 1bou on RCSB PDB site
Description: three-dimensional structure of ligab
Class: dioxygenase
Keywords: extradiol type dioxygenase, oxidoreductase
Deposited on 1998-08-06, released 1999-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.149
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4,5-dioxygenase alpha chain
    Species: Sphingomonas paucimobilis [TaxId:13689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1boua_
  • Chain 'B':
    Compound: 4,5-dioxygenase beta chain
    Species: Sphingomonas paucimobilis [TaxId:13689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1boub_
  • Chain 'C':
    Compound: 4,5-dioxygenase alpha chain
    Species: Sphingomonas paucimobilis [TaxId:13689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bouc_
  • Chain 'D':
    Compound: 4,5-dioxygenase beta chain
    Species: Sphingomonas paucimobilis [TaxId:13689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1boud_
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bouA (A:)
    mtekkeridvhaylaefddipgtrvftaqrarkgynlnqfamslmkaenrerfkadesay
    ldewnltpaakaavlardynamideggnvyflsklfstdgksfqfaagsmtgmtqeeyaq
    mmidggrspagvrsikggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bouA (A:)
    idvhaylaefddipgtrvftaqrarkgynlnqfamslmkaenrerfkadesayldewnlt
    paakaavlardynamideggnvyflsklfstdgksfqfaagsmtgmtqeeyaqmmidggr
    spagvrsikggy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bouB (B:)
    marvttgitsshipalgaaiqtgtsdndywgpvfkgyqpirdwikqpgnmpdvvilvynd
    hasafdmniiptfaigcaetfkpadegwgprpvpdvkghpdlawhiaqslildefdmtim
    nqmdvdhgctvplsmifgepeewpckvipfpvnvvtypppsgkrcfalgdsiraavesfp
    edlnvhvwgtggmshqlqgpraglinkefdlnfidklisdpeelskmphiqylresgseg
    velvmwlimrgalpekvrdlytfyhipasntalgamilqpeetagtpleprkvmsghsla
    qa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bouB (B:)
    arvttgitsshipalgaaiqtgtsdndywgpvfkgyqpirdwikqpgnmpdvvilvyndh
    asafdmniiptfaigcaetfkpadegwgprpvpdvkghpdlawhiaqslildefdmtimn
    qmdvdhgctvplsmifgepeewpckvipfpvnvvtypppsgkrcfalgdsiraavesfpe
    dlnvhvwgtggmshqlqgpraglinkefdlnfidklisdpeelskmphiqylresgsegv
    elvmwlimrgalpekvrdlytfyhipasntalgamilqpeetagtpleprkvmsghsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bouC (C:)
    mtekkeridvhaylaefddipgtrvftaqrarkgynlnqfamslmkaenrerfkadesay
    ldewnltpaakaavlardynamideggnvyflsklfstdgksfqfaagsmtgmtqeeyaq
    mmidggrspagvrsikggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bouC (C:)
    idvhaylaefddipgtrvftaqrarkgynlnqfamslmkaenrerfkadesayldewnlt
    paakaavlardynamideggnvyflsklfstdgksfqfaagsmtgmtqeeyaqmmidggr
    spagvrsikggy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bouD (D:)
    marvttgitsshipalgaaiqtgtsdndywgpvfkgyqpirdwikqpgnmpdvvilvynd
    hasafdmniiptfaigcaetfkpadegwgprpvpdvkghpdlawhiaqslildefdmtim
    nqmdvdhgctvplsmifgepeewpckvipfpvnvvtypppsgkrcfalgdsiraavesfp
    edlnvhvwgtggmshqlqgpraglinkefdlnfidklisdpeelskmphiqylresgseg
    velvmwlimrgalpekvrdlytfyhipasntalgamilqpeetagtpleprkvmsghsla
    qa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bouD (D:)
    arvttgitsshipalgaaiqtgtsdndywgpvfkgyqpirdwikqpgnmpdvvilvyndh
    asafdmniiptfaigcaetfkpadegwgprpvpdvkghpdlawhiaqslildefdmtimn
    qmdvdhgctvplsmifgepeewpckvipfpvnvvtypppsgkrcfalgdsiraavesfpe
    dlnvhvwgtggmshqlqgpraglinkefdlnfidklisdpeelskmphiqylresgsegv
    elvmwlimrgalpekvrdlytfyhipasntalgamilqpeetagtpleprkvmsghsl