PDB entry 1bot

View 1bot on RCSB PDB site
Description: crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate.
Class: transferase
Keywords: kinase, allosteric regulation, fructose bisphosphate, transferase
Deposited on 1998-08-05, released 1999-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.219
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: protein (glycerol kinase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1boto1, d1boto2
  • Chain 'Z':
    Compound: protein (glycerol kinase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1botz1, d1botz2
  • Heterogens: EPE, GOL

PDB Chain Sequences:

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1botO (O:)
    tekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstl
    vevlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgl
    edyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhv
    tdytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripis
    giagdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevny
    alegavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpya
    rgaifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmq
    fqsdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgiettern
    yryagwkkavkramaweehde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1botO (O:)
    kkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlve
    vlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgled
    yirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtd
    ytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgi
    agdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyal
    egavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyarg
    aifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfq
    sdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgietternyr
    yagwkkavkramaweeh
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1botZ (Z:)
    tekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstl
    vevlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgl
    edyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhv
    tdytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripis
    giagdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevny
    alegavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpya
    rgaifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmq
    fqsdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgiettern
    yryagwkkavkramaweehde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1botZ (Z:)
    ekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlv
    evlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgle
    dyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvt
    dytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisg
    iagdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnya
    legavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyar
    gaifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqf
    qsdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgietterny
    ryagwkkavkramaweeh