PDB entry 1boq

View 1boq on RCSB PDB site
Description: pro region c-terminus: protease active site interactions are critical in catalyzing the folding of alpha-lytic protease
Class: hydrolase
Keywords: serine protease, folding mutant, hydrolase
Deposited on 1998-08-05, released 1998-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.159
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (alpha-lytic protease)
    Species: Lysobacter enzymogenes [TaxId:69]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00778 (0-197)
      • engineered (118)
    Domains in SCOPe 2.07: d1boqa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1boqA (A:)
    anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
    gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknit
    anyaegavrgltqgnacmgrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
    ferlqpilsqyglslvtg