PDB entry 1boq

View 1boq on RCSB PDB site
Description: pro region c-terminus: protease active site interactions are critical in catalyzing the folding of alpha-lytic protease
Class: hydrolase
Keywords: serine protease, folding mutant
Deposited on 1998-08-05, released 1998-08-12
The last revision prior to the SCOP 1.75 freeze date was dated 1999-12-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.159
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (alpha-lytic protease)
  Species: Lysobacter enzymogenes
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00778 (0-197)
    • engineered (118)
  Domains in SCOP 1.75: d1boqa_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1boqA (A:)
  anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
  gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknit
  anyaegavrgltqgnacmgrgdsggswitsagqaqgvmsggnvqsngnncgipasqrssl
  ferlqpilsqyglslvtg