PDB entry 1boo

View 1boo on RCSB PDB site
Description: pvuii DNA methyltransferase (cytosine-n4-specific)
Class: transferase
Keywords: type II DNA-(cytosine n4) methyltransferase, amino methylation, selenomethionine, multiwavelength anomalous diffraction
Deposited on 1998-07-31, released 1998-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.193
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (n-4 cytosine-specific methyltransferase pvu II)
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11409
      • sequence conflict (30)
    Domains in SCOPe 2.07: d1booa_
  • Heterogens: SAH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1booA (A:)
    mlnfgkkpayttsngsmyigdslellesfpeesislvmtsppfalqrkkeygnleqheyv
    dwflsfakvvnkklkpdgsfvvdfggaymkgvparsiynfrvlirmidevgfflaedfyw
    fnpsklpspiewvnkrkirvkdavntvwwfsktewpksditkvlapysdrmkkliedpdk
    fytpktrpsghdigksfskdnggsippnllqisnsesngqylancklmgikahparfpak
    lpeffirmltepddlvvdifggsnttglvaeresrkwisfemkpeyvaasafrfldnnis
    eekitdiynrilngesldlnsii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1booA (A:)
    nfgkkpayttsngsmyigdslellesfpeesislvmtsppfalqrkkeygnleqheyvdw
    flsfakvvnkklkpdgsfvvdfggaymkgvparsiynfrvlirmidevgfflaedfywfn
    psklpspiewvnkrkirvkdavntvwwfsktewpksditkvlasippnllqisnsesngq
    ylancklmgikahparfpaklpeffirmltepddlvvdifggsnttglvaeresrkwisf
    emkpeyvaasafrfldnniseekitdiynrilngesldlnsi