PDB entry 1bol

View 1bol on RCSB PDB site
Description: the crystal structure of ribonuclease rh from rhizopus niveus at 2.0 a resolution
Deposited on 1998-08-05, released 1998-08-12
The last revision prior to the SCOP 1.65 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1bola_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bolA (A:)
    sscsstalscsnsansdtccspeyglvvlnmqwapgygpdnaftlhglwpdkcsgayaps
    ggcdsnrasssiasvikskdsslynsmltywpsnqgnnnvfwshewskhgtcvstydpdc
    ydnyeegedivdyfqkamdlrsqynvykafssngitpggtytatemqsaiesyfgakaki
    dcssgtlsdvalyfyvrgrdtyvitdalstgscsgdveyptk