PDB entry 1bol

View 1bol on RCSB PDB site
Description: the crystal structure of ribonuclease rh from rhizopus niveus at 2.0 a resolution
Class: hydrolase
Keywords: ribonucleases, hydrolase
Deposited on 1998-08-05, released 1998-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribonuclease rh)
    Species: Rhizopus niveus [TaxId:4844]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bola_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bolA (A:)
sscsstalscsnsansdtccspeyglvvlnmqwapgygpdnaftlhglwpdkcsgayaps
ggcdsnrasssiasvikskdsslynsmltywpsnqgnnnvfwshewskhgtcvstydpdc
ydnyeegedivdyfqkamdlrsqynvykafssngitpggtytatemqsaiesyfgakaki
dcssgtlsdvalyfyvrgrdtyvitdalstgscsgdveyptk