PDB entry 1boi

View 1boi on RCSB PDB site
Description: n-terminally truncated rhodanese
Deposited on 1998-08-04, released 1999-04-27
The last revision prior to the SCOP 1.67 freeze date was dated 1999-04-27, with a file datestamp of 1999-04-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.162
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1boi_ (-)
    vhqvlyralvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdi
    eecrdkaspyevmlpseagfadyvgslgisndthvvvydgddlgsfyaprvwwmfrvfgh
    rtvsvlnggfrnwlkeghpvtsepsrpepaifkatlnrsllktyeqvlenleskrfqlvd
    sraqgrylgtqpepdavgldsghirgsvnmpfmnfltedgfekspeelramfeakkvdlt
    kpliatcrkgvtachialaaylcgkpdvaiydgswfewfhrappetwvsqgkggka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1boi_ (-)
    alvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdieecrdka
    spyevmlpseagfadyvgslgisndthvvvydgddlgsfyaprvwwmfrvfghrtvsvln
    ggfrnwlkeghpvtsepsrpepaifkatlnrsllktyeqvlenleskrfqlvdsraqgry
    lgtqpepdavgldsghirgsvnmpfmnfltedgfekspeelramfeakkvdltkpliatc
    rkgvtachialaaylcgkpdvaiydgswfewfhrappetwvsqgkg