PDB entry 1boi

View 1boi on RCSB PDB site
Description: n-terminally truncated rhodanese
Class: transferase
Keywords: transferase, rhodanese, sulfurtransferase
Deposited on 1998-08-04, released 1999-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.162
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhodanese
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00586
      • modified residue (246)
    Domains in SCOPe 2.08: d1boia1, d1boia2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1boiA (A:)
    vhqvlyralvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdi
    eecrdkaspyevmlpseagfadyvgslgisndthvvvydgddlgsfyaprvwwmfrvfgh
    rtvsvlnggfrnwlkeghpvtsepsrpepaifkatlnrsllktyeqvlenleskrfqlvd
    sraqgrylgtqpepdavgldsghirgsvnmpfmnfltedgfekspeelramfeakkvdlt
    kpliatcrkgvtachialaaylcgkpdvaiydgswfewfhrappetwvsqgkggka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1boiA (A:)
    alvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdieecrdka
    spyevmlpseagfadyvgslgisndthvvvydgddlgsfyaprvwwmfrvfghrtvsvln
    ggfrnwlkeghpvtsepsrpepaifkatlnrsllktyeqvlenleskrfqlvdsraqgry
    lgtqpepdavgldsghirgsvnmpfmnfltedgfekspeelramfeakkvdltkpliatc
    rkgvtachialaaylcgkpdvaiydgswfewfhrappetwvsqgkg