PDB entry 1bof

View 1bof on RCSB PDB site
Description: gi-alpha-1 bound to GDP and magnesium
Class: signal transduction protein
Keywords: signal transduction protein, GTP-ase, g protein
Deposited on 1998-08-04, released 1999-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.227
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gi alpha 1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bofa1, d1bofa2
  • Heterogens: SO4, MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bofA (A:)
    gctlsaedkaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagy
    seeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmta
    elagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt
    tgivethftfkdlhfkmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemn
    rmhesmklfdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeaaa
    yiqcqfedlnkrkdtkeiythftcatdtknvqfvfdavtdviiknnlkdcglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bofA (A:)
    kaaverskmidrnlredgekaarevkllllgagesgkstivkqmkiiheagyseeeckqy
    kavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmtaelagvikr
    lwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkttgivethf
    tfkdlhfkmfdvggvtaiifcvalsdydlmnrmhesmklfdsicnnkwftdtsiilflnk
    kdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtk
    nvqfvfdavtdviiknnlkdcglf