PDB entry 1boe

View 1boe on RCSB PDB site
Description: structure of the igf binding domain of the insulin-like growth factor-binding protein-5 (igfbp-5): implications for igf and igf-I receptor interactions
Class: hormone/growth factor
Keywords: mini-igfbp-5, igfbp-5, igf, insulin-like growth factor binding protein, nmr
Deposited on 1998-07-30, released 1998-12-16
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (insulin-like growth factor-binding protein-5 (igfbp-5))
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1boea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1boeA (A:)
    alaegqscgvytercaqglrclprqdeekplhallhgrgvclneksy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1boeA (A:)
    alaegqscgvytercaqglrclprqdeekplhallhgrgvclneks