PDB entry 1boe

View 1boe on RCSB PDB site
Description: structure of the igf binding domain of the insulin-like growth factor-binding protein-5 (igfbp-5): implications for igf and igf-I receptor interactions
Class: hormone/growth factor
Keywords: mini-igfbp-5, igfbp-5, igf, insulin-like growth factor binding protein, nmr, hormone/growth factor complex
Deposited on 1998-07-30, released 1998-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (insulin-like growth factor-binding protein-5 (igfbp-5))
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24593 (0-End)
  Domains in SCOPe 2.08: d1boea_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1boeA (A:)
  alaegqscgvytercaqglrclprqdeekplhallhgrgvclneksy
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1boeA (A:)
  alaegqscgvytercaqglrclprqdeekplhallhgrgvclneks