PDB entry 1bod

View 1bod on RCSB PDB site
Description: the solution structures of mutant calbindin d9k's, as determined by nmr, show that the calcium binding site can adopt different folds
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1993-04-23, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calbindin d9k
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02633 (1-73)
      • engineered mutation (14)
      • engineered mutation (19)
      • engineered mutation (41)
    Domains in SCOPe 2.08: d1boda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bodA (A:)
mkspeelkgifekydkegdgqlskeelklllqtefpsllkgmstldelfeeldkngdgev
sfeefqvlvkkisq