PDB entry 1boc

View 1boc on RCSB PDB site
Description: the solution structures of mutant calbindin d9k's, as determined by nmr, show that the calcium binding site can adopt different folds
Deposited on 1993-04-23, released 1993-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1boc__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1boc_ (-)
  mkspeelkgifekyadkegdgnqlskeelklllqtefpsllkgmstldelfeeldkngdg
  evsfeefqvlvkkisq