PDB entry 1bob

View 1bob on RCSB PDB site
Description: histone acetyltransferase hat1 from saccharomyces cerevisiae in complex with acetyl coenzyme a
Class: acetyltransferase
Keywords: histone acetyltransferase, histone modification, acetyl coenzyme a binding-protein
Deposited on 1998-07-02, released 1999-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone acetyltransferase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1boba_
  • Heterogens: CA, ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bobA (A:)
    msandfkpetwtssanealrvsivgenavqfsplftypiygdsekiygykdliihlafds
    vtfkpyvnvkysaklgddnivdvekkllsflpkddvivrdeakwvdcfaeerkthnlsdv
    fekvseyslngeefvvyksslvddfarrmhrrvqifsllfieaanyidetdpswqiywll
    nkktkeligfvttykywhylgaksfdedidkkfrakisqflifppyqnkghgsclyeaii
    qswledksiteitvedpneafddlrdrndiqrlrklgydavfqkhsdlsdeflessrksl
    kleerqfnrlvemllllnns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bobA (A:)
    fkpetwtssanealrvsivgenavqfsplftypiygdsekiygykdliihlafdsvtfkp
    yvnvkysaklgddnivdvekkllsflpkddvivrdeakwvdcfaeerkthnlsdvfekvs
    eyslngeefvvyksslvddfarrmhrrvqifsllfieaanyidetdpswqiywllnkktk
    eligfvttykywhyidkkfrakisqflifppyqnkghgsclyeaiiqswledksiteitv
    edpneafddlrdrndiqrlrklgydavfqkhsdlsdeflessrkslkleerqfnrlveml
    lllnns